PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_021903-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 359aa    MW: 39961.8 Da    PI: 6.3688
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_021903-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.11.1e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+++++++G g+W++ +r  g++R++k+c++rw +yl
    NNU_021903-RA 14 KGPWTPEEDQKLIEYIQKHGHGSWRALPRLAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding53.74.7e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+++ eE++++++++  lG++ W++Ia+ ++ gRt++++k++w+++
    NNU_021903-RA  67 RGKFSDEEEQIIINLHSVLGNK-WSAIANQLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.5E-26564IPR009057Homeodomain-like
PROSITE profilePS5129419.846961IPR017930Myb domain
SuperFamilySSF466891.54E-3211108IPR009057Homeodomain-like
SMARTSM007171.8E-161363IPR001005SANT/Myb domain
PfamPF002492.5E-181461IPR001005SANT/Myb domain
CDDcd001673.15E-131661No hitNo description
PROSITE profilePS5129427.01462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.2E-2765116IPR009057Homeodomain-like
SMARTSM007171.5E-1566114IPR001005SANT/Myb domain
PfamPF002491.5E-1567111IPR001005SANT/Myb domain
CDDcd001674.20E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MARSPCCDDS GLKKGPWTPE EDQKLIEYIQ KHGHGSWRAL PRLAGLNRCG KSCRLRWTNY  60
LRPDIRRGKF SDEEEQIIIN LHSVLGNKWS AIANQLPGRT DNEIKNYWNT HIRKKLLQMG  120
IDPVTHRPRT DLNLLANLPQ FLAVANLNNL MGSWDNSLRL QAEAAQLARS QLFQNLLQAN  180
MNTPTPPNSN PFNLLRSASF QGQNFAEHAG SNAQLEGLLS NLLGPGPDDH HTHHMPSTTS  240
TNLGIQEPSN VNDYNQILDS SVYLGGFGST LCDSNGSSIS DQNLISSSYD ISALDIIPPL  300
VSVDPKMEAK STPSTSTTFD AWGELNLDCE PTNYWGDMIE YVFYISILLS TNHLRGLGH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-33121165108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010240897.10.0PREDICTED: transcription factor MYB39-like
RefseqXP_010240896.10.0PREDICTED: transcription factor MYB39-like
SwissprotQ8GWP01e-76MYB39_ARATH; Transcription factor MYB39
TrEMBLF6HEE41e-118F6HEE4_VITVI; Putative uncharacterized protein
STRINGVIT_16s0039g01710.t011e-118(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.25e-91myb domain protein 9